Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143972.1 | 5prime_partial | 185 | 2-559(+) |
Amino Acid sequence : | |||
EKVTMGMRALPLSSHPYSQSPSIGFSALANSETIPNRRRIRMGRIQARAEEKNDGEEDEEEPKKKSKQSPLGSIMEALDFSQVRSSEDAELLDEAREATQSGGKMSREQYGALRRKIGGT YKDFFKSYVDVDGEYVEEGWVDKTCKVCKKDTREEPRQVDNLGRYVHVACLEKSKSTNFFSKFFS* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 21,021.265 | ||
Theoretical pI: | 7.028 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 55.665 | ||
aromaticity | 0.081 | ||
GRAVY | -0.941 | ||
Secondary Structure Fraction | |||
Helix | 0.222 | ||
turn | 0.243 | ||
sheet | 0.254 |