| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143975.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| GASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARC RGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFY | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,342.014 | ||
| Theoretical pI: | 7.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 28.705 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.204 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.266 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143975.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| GASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARC RGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFY | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,342.014 | ||
| Theoretical pI: | 7.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 28.705 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.204 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.266 | ||
| sheet | 0.228 | ||