Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143976.1 | complete | 128 | 110-496(+) |
Amino Acid sequence : | |||
MLVLRVPGRQTSFALTIWSVPLKLPAAKASRVARWTAASEFSWHSLVPTRTMLFSTHGTKCLSSVSTLSMDCTPTSRVLSQTNSLTSSNIAHLVWTCLVIFTWSFPHTFPLLLLEDVKNL IMTWASKH* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,660.211 | ||
Theoretical pI: | 7.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 28.605 | ||
aromaticity | 0.121 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.266 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143976.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
ARSLPAFVSNSTYTVTSFTLVLEFQKGTLQNLYWKRDACASCSGKTNFVCLNNLECAIKTSSCKGQQGGSVDCSVGIQLAFSGTDKNDAVLNSWYEVSKLRQYSLYGLYSDLKSSLTDQF TDIF* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,660.211 | ||
Theoretical pI: | 7.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 28.605 | ||
aromaticity | 0.121 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.266 | ||
sheet | 0.194 |