| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144013.1 | 3prime_partial | 218 | 23-676(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASV | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 22,920.048 | ||
| Theoretical pI: | 6.646 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 31.692 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.180 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.257 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144013.1 | 3prime_partial | 218 | 23-676(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASV | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 22,920.048 | ||
| Theoretical pI: | 6.646 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 31.692 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.180 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.257 | ||
| sheet | 0.243 | ||