Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144023.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
GLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRY IPFGVGRRSCPGIILALPIL | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 10,866.538 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.102 | ||
aromaticity | 0.079 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.356 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144023.1 | 5prime_partial | 135 | 422-15(-) |
Amino Acid sequence : | |||
EYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFLDVGLGDLNARAEDR VELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 10,866.538 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.102 | ||
aromaticity | 0.079 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.356 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144023.1 | 5prime_partial | 101 | 421-116(-) |
Amino Acid sequence : | |||
SIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTTAWR* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,866.538 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.102 | ||
aromaticity | 0.079 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.356 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144023.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
GLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRY IPFGVGRRSCPGIILALPIL | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 10,866.538 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.102 | ||
aromaticity | 0.079 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.356 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144023.1 | 5prime_partial | 135 | 422-15(-) |
Amino Acid sequence : | |||
EYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFLDVGLGDLNARAEDR VELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 10,866.538 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.102 | ||
aromaticity | 0.079 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.356 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144023.1 | 5prime_partial | 101 | 421-116(-) |
Amino Acid sequence : | |||
SIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTTAWR* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,866.538 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.102 | ||
aromaticity | 0.079 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.356 | ||
sheet | 0.267 |