| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144023.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
| GLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRY IPFGVGRRSCPGIILALPIL | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 10,866.538 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 55.102 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.356 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144023.1 | 5prime_partial | 135 | 422-15(-) |
Amino Acid sequence : | |||
| EYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFLDVGLGDLNARAEDR VELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 10,866.538 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 55.102 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.356 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144023.1 | 5prime_partial | 101 | 421-116(-) |
Amino Acid sequence : | |||
| SIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTTAWR* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,866.538 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 55.102 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.356 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144023.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
| GLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRY IPFGVGRRSCPGIILALPIL | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 10,866.538 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 55.102 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.356 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144023.1 | 5prime_partial | 135 | 422-15(-) |
Amino Acid sequence : | |||
| EYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFLDVGLGDLNARAEDR VELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 10,866.538 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 55.102 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.356 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144023.1 | 5prime_partial | 101 | 421-116(-) |
Amino Acid sequence : | |||
| SIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTTAWR* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,866.538 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 55.102 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.356 | ||
| sheet | 0.267 | ||