| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144032.1 | internal | 120 | 1-360(+) |
Amino Acid sequence : | |||
| AIALYLCRKGIRVMMLTLSTERFMKIKKEAAPECQQYLVQVTKYQAAQNCKTWVVGKWLMPREQRWAPPGTHFHQFVVPPIFSFRRDCTYGKLAAMRLPKDVQGLGACEYTLDRGVVHAC | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,822.246 | ||
| Theoretical pI: | 9.622 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 34.888 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.142 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144032.1 | internal | 120 | 1-360(+) |
Amino Acid sequence : | |||
| AIALYLCRKGIRVMMLTLSTERFMKIKKEAAPECQQYLVQVTKYQAAQNCKTWVVGKWLMPREQRWAPPGTHFHQFVVPPIFSFRRDCTYGKLAAMRLPKDVQGLGACEYTLDRGVVHAC | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,822.246 | ||
| Theoretical pI: | 9.622 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 34.888 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.142 | ||
| sheet | 0.258 | ||