| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144043.1 | internal | 169 | 2-508(+) |
Amino Acid sequence : | |||
| HEVIHISASHNHASFVMQSGEVFTCGDNSSYCCGHGEVGRAIFRPTRIESLKGIPCKQVATGLSFTVFLTMQGHVYTCGNNTHGQLGHADTLDRPIPRKVEAFEGLGHVVQVAAGASYTF ALTDDGTVHSFGSCTNFCLGHGDQHDELLPRAIQSFQRRNIHVVRVSAG | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 18,247.262 | ||
| Theoretical pI: | 6.692 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 26.459 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.254 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144043.1 | internal | 169 | 2-508(+) |
Amino Acid sequence : | |||
| HEVIHISASHNHASFVMQSGEVFTCGDNSSYCCGHGEVGRAIFRPTRIESLKGIPCKQVATGLSFTVFLTMQGHVYTCGNNTHGQLGHADTLDRPIPRKVEAFEGLGHVVQVAAGASYTF ALTDDGTVHSFGSCTNFCLGHGDQHDELLPRAIQSFQRRNIHVVRVSAG | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 18,247.262 | ||
| Theoretical pI: | 6.692 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 26.459 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.254 | ||
| sheet | 0.183 | ||