Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144043.1 | internal | 169 | 2-508(+) |
Amino Acid sequence : | |||
HEVIHISASHNHASFVMQSGEVFTCGDNSSYCCGHGEVGRAIFRPTRIESLKGIPCKQVATGLSFTVFLTMQGHVYTCGNNTHGQLGHADTLDRPIPRKVEAFEGLGHVVQVAAGASYTF ALTDDGTVHSFGSCTNFCLGHGDQHDELLPRAIQSFQRRNIHVVRVSAG | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,247.262 | ||
Theoretical pI: | 6.692 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 26.459 | ||
aromaticity | 0.077 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.254 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144043.1 | internal | 169 | 2-508(+) |
Amino Acid sequence : | |||
HEVIHISASHNHASFVMQSGEVFTCGDNSSYCCGHGEVGRAIFRPTRIESLKGIPCKQVATGLSFTVFLTMQGHVYTCGNNTHGQLGHADTLDRPIPRKVEAFEGLGHVVQVAAGASYTF ALTDDGTVHSFGSCTNFCLGHGDQHDELLPRAIQSFQRRNIHVVRVSAG | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,247.262 | ||
Theoretical pI: | 6.692 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 26.459 | ||
aromaticity | 0.077 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.254 | ||
sheet | 0.183 |