| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144051.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
| QKTLYGVLRGFVEGISADAGGGEPLARRIRSSFFRTAPHLREASRNSVHDLLRWTRQGSPLRALLVISVGTITLISLTGLLVFMIFFVAATLNAIIISALLSLAAAGGFLALFFACLTGI YIAALSTAVFVISAITISTIIAVMVATGWIGFFCIIWLAAKKSMDLTKQSL | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,264.556 | ||
| Theoretical pI: | 10.560 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 37.610 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.973 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.199 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144051.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
| QKTLYGVLRGFVEGISADAGGGEPLARRIRSSFFRTAPHLREASRNSVHDLLRWTRQGSPLRALLVISVGTITLISLTGLLVFMIFFVAATLNAIIISALLSLAAAGGFLALFFACLTGI YIAALSTAVFVISAITISTIIAVMVATGWIGFFCIIWLAAKKSMDLTKQSL | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,264.556 | ||
| Theoretical pI: | 10.560 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 37.610 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.973 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.199 | ||
| sheet | 0.310 | ||