Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144064.1 | internal | 160 | 1-480(+) |
Amino Acid sequence : | |||
ARGDSIYPLVPGHEIVGVVTEIGSSVSHFKIGDNIGVGTYVNSCRDCENCNEYIENHCSKGGLVLTFNGKDSDGTVTKGGYSSYIVVHERYCFKIPDGYPLAMAAPLLCAGITVYTPMMH HNMKQPGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSE | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,006.348 | ||
Theoretical pI: | 7.204 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12295 | ||
Instability index: | 25.141 | ||
aromaticity | 0.088 | ||
GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.306 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144064.1 | internal | 160 | 1-480(+) |
Amino Acid sequence : | |||
ARGDSIYPLVPGHEIVGVVTEIGSSVSHFKIGDNIGVGTYVNSCRDCENCNEYIENHCSKGGLVLTFNGKDSDGTVTKGGYSSYIVVHERYCFKIPDGYPLAMAAPLLCAGITVYTPMMH HNMKQPGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSE | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,006.348 | ||
Theoretical pI: | 7.204 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12295 | ||
Instability index: | 25.141 | ||
aromaticity | 0.088 | ||
GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.306 | ||
sheet | 0.181 |