| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144069.1 | 3prime_partial | 108 | 324-1(-) |
Amino Acid sequence : | |||
| MQIQQVYSYISHNCNFHAVVVSAASLISGSAASLVSGSGAQNEVFFPVFETVWRTASGVTLPFTVTFCSLMSISNDSTPSILVRTLLTAPTQPSQDIPTLRRTVSAIG | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,481.944 | ||
| Theoretical pI: | 6.693 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 40.506 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.296 | ||
| sheet | 0.194 | ||