Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144069.1 | 3prime_partial | 108 | 324-1(-) |
Amino Acid sequence : | |||
MQIQQVYSYISHNCNFHAVVVSAASLISGSAASLVSGSGAQNEVFFPVFETVWRTASGVTLPFTVTFCSLMSISNDSTPSILVRTLLTAPTQPSQDIPTLRRTVSAIG | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,481.944 | ||
Theoretical pI: | 6.693 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 40.506 | ||
aromaticity | 0.083 | ||
GRAVY | 0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.296 | ||
sheet | 0.194 |