| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144072.1 | 5prime_partial | 179 | 2-541(+) |
Amino Acid sequence : | |||
| QGMRPGVVPYRNVFSALRRIAHEEGIRGLYSGLFPALAGVSHVAIQFPAYEKMKAYLAERDKTTVDNLSPGKIAIASSLSKFLASTITYPHEVVRSRLQEQGQARDSVAHYKGAVDCTKR VYQKEGLRGFYRGCATNLLRTIPAAVITFTSYEMIQRFLNRTFPADYNSHPEIYLKPGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,058.812 | ||
| Theoretical pI: | 9.805 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
| Instability index: | 40.634 | ||
| aromaticity | 0.106 | ||
| GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.223 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144072.1 | 5prime_partial | 179 | 2-541(+) |
Amino Acid sequence : | |||
| QGMRPGVVPYRNVFSALRRIAHEEGIRGLYSGLFPALAGVSHVAIQFPAYEKMKAYLAERDKTTVDNLSPGKIAIASSLSKFLASTITYPHEVVRSRLQEQGQARDSVAHYKGAVDCTKR VYQKEGLRGFYRGCATNLLRTIPAAVITFTSYEMIQRFLNRTFPADYNSHPEIYLKPGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,058.812 | ||
| Theoretical pI: | 9.805 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
| Instability index: | 40.634 | ||
| aromaticity | 0.106 | ||
| GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.223 | ||
| sheet | 0.246 | ||