Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144072.1 | 5prime_partial | 179 | 2-541(+) |
Amino Acid sequence : | |||
QGMRPGVVPYRNVFSALRRIAHEEGIRGLYSGLFPALAGVSHVAIQFPAYEKMKAYLAERDKTTVDNLSPGKIAIASSLSKFLASTITYPHEVVRSRLQEQGQARDSVAHYKGAVDCTKR VYQKEGLRGFYRGCATNLLRTIPAAVITFTSYEMIQRFLNRTFPADYNSHPEIYLKPGK* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 20,058.812 | ||
Theoretical pI: | 9.805 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
Instability index: | 40.634 | ||
aromaticity | 0.106 | ||
GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.223 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144072.1 | 5prime_partial | 179 | 2-541(+) |
Amino Acid sequence : | |||
QGMRPGVVPYRNVFSALRRIAHEEGIRGLYSGLFPALAGVSHVAIQFPAYEKMKAYLAERDKTTVDNLSPGKIAIASSLSKFLASTITYPHEVVRSRLQEQGQARDSVAHYKGAVDCTKR VYQKEGLRGFYRGCATNLLRTIPAAVITFTSYEMIQRFLNRTFPADYNSHPEIYLKPGK* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 20,058.812 | ||
Theoretical pI: | 9.805 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
Instability index: | 40.634 | ||
aromaticity | 0.106 | ||
GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.223 | ||
sheet | 0.246 |