| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144073.1 | 5prime_partial | 131 | 1-396(+) |
Amino Acid sequence : | |||
| GRIASTTIPVMFGRSLEVPESCNGIARFNFEYLCGRPVGAADYIAIARNYHTVFISDIPVMSMRIRDKARRFITLIDEMYNHHCCLFCLAATSIDNLFQGTEEGTLFDLESFQFETGDRN WETSTRCFSNR* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,980.861 | ||
| Theoretical pI: | 5.568 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 36.573 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.214 | ||
| sheet | 0.229 | ||