| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144078.1 | internal | 180 | 1-540(+) |
Amino Acid sequence : | |||
| ARGTMEEDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDA STSHSNNGIDEGNAQQSYQMDMNNISSTSTDAFAVPMFSTESSENFWTVEDFWTMQPLNG | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,853.085 | ||
| Theoretical pI: | 6.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 45950 | ||
| Instability index: | 47.414 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.849 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.267 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144078.1 | internal | 180 | 1-540(+) |
Amino Acid sequence : | |||
| ARGTMEEDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDA STSHSNNGIDEGNAQQSYQMDMNNISSTSTDAFAVPMFSTESSENFWTVEDFWTMQPLNG | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,853.085 | ||
| Theoretical pI: | 6.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 45950 | ||
| Instability index: | 47.414 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.849 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.267 | ||
| sheet | 0.239 | ||