Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144082.1 | internal | 189 | 2-568(+) |
Amino Acid sequence : | |||
NIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERF IDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNWELPAGIFKDDINMDESPGIAIH | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 14,433.840 | ||
Theoretical pI: | 9.170 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
Instability index: | 33.768 | ||
aromaticity | 0.150 | ||
GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.208 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144082.1 | complete | 120 | 391-29(-) |
Amino Acid sequence : | |||
MTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFVLCFLHCGWFFNELRKYPFYDCR * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 14,433.840 | ||
Theoretical pI: | 9.170 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
Instability index: | 33.768 | ||
aromaticity | 0.150 | ||
GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.208 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144082.1 | internal | 189 | 2-568(+) |
Amino Acid sequence : | |||
NIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERF IDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNWELPAGIFKDDINMDESPGIAIH | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 14,433.840 | ||
Theoretical pI: | 9.170 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
Instability index: | 33.768 | ||
aromaticity | 0.150 | ||
GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.208 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144082.1 | complete | 120 | 391-29(-) |
Amino Acid sequence : | |||
MTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFVLCFLHCGWFFNELRKYPFYDCR * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 14,433.840 | ||
Theoretical pI: | 9.170 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
Instability index: | 33.768 | ||
aromaticity | 0.150 | ||
GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.208 | ||
sheet | 0.183 |