| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144092.1 | internal | 150 | 1-450(+) |
Amino Acid sequence : | |||
| NLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVKKEYELDDTQMGVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMR NSEGLYMPRYGLLRNLRDRSLARYAFDFYE | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,631.914 | ||
| Theoretical pI: | 4.866 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 36.923 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.487 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.213 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144092.1 | internal | 150 | 1-450(+) |
Amino Acid sequence : | |||
| NLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVKKEYELDDTQMGVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMR NSEGLYMPRYGLLRNLRDRSLARYAFDFYE | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,631.914 | ||
| Theoretical pI: | 4.866 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 36.923 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.487 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.213 | ||
| sheet | 0.287 | ||