Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144096.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
ARGTLTYELDAPLPAAKLWAVYGTLRMLELIVELLPQFASAIEILKGDGGTGTVIRIAMNNAPGASGPVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRS SLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLCFDYKLWFKRLFQSKARGVKISDAM* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 11,967.191 | ||
Theoretical pI: | 11.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 62.455 | ||
aromaticity | 0.067 | ||
GRAVY | -1.133 | ||
Secondary Structure Fraction | |||
Helix | 0.200 | ||
turn | 0.314 | ||
sheet | 0.143 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144096.1 | 5prime_partial | 105 | 3-320(+) |
Amino Acid sequence : | |||
TRNPNLRVGCSSPGSKAVGSLRHASYAGAHRRIASSICVGHRNFERRWWDRHCHSDRHEQRPRSIGTRLPDREVYEGGRRTEGEGRGGDPRRNVGFRVSLVPKHF* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,967.191 | ||
Theoretical pI: | 11.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 62.455 | ||
aromaticity | 0.067 | ||
GRAVY | -1.133 | ||
Secondary Structure Fraction | |||
Helix | 0.200 | ||
turn | 0.314 | ||
sheet | 0.143 |