| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144096.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
| ARGTLTYELDAPLPAAKLWAVYGTLRMLELIVELLPQFASAIEILKGDGGTGTVIRIAMNNAPGASGPVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRS SLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLCFDYKLWFKRLFQSKARGVKISDAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 11,967.191 | ||
| Theoretical pI: | 11.419 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 62.455 | ||
| aromaticity | 0.067 | ||
| GRAVY | -1.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.314 | ||
| sheet | 0.143 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144096.1 | 5prime_partial | 105 | 3-320(+) |
Amino Acid sequence : | |||
| TRNPNLRVGCSSPGSKAVGSLRHASYAGAHRRIASSICVGHRNFERRWWDRHCHSDRHEQRPRSIGTRLPDREVYEGGRRTEGEGRGGDPRRNVGFRVSLVPKHF* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,967.191 | ||
| Theoretical pI: | 11.419 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 62.455 | ||
| aromaticity | 0.067 | ||
| GRAVY | -1.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.314 | ||
| sheet | 0.143 | ||