Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144097.1 | 5prime_partial | 161 | 2-487(+) |
Amino Acid sequence : | |||
DSFFGLFSIKMSIISFPTSCTIKCNFRTQSPYALAKGPTSLGSFKNVSKSFGLKQSSCFKATAMAVYKVKLVTPEGEEHEFEAPDDAYILDSAETAGLELPYSCRAGACSTCAGKIVSGS VDQSDGSFLDESQVENGYALTCVSYPTADCVIHTHKESDLY* | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 17,294.257 | ||
Theoretical pI: | 4.978 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10930 | ||
Instability index: | 43.768 | ||
aromaticity | 0.106 | ||
GRAVY | -0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.267 | ||
sheet | 0.230 |