Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144099.1 | 5prime_partial | 120 | 1-363(+) |
Amino Acid sequence : | |||
IDSGVGMTKTDLVNNLGTIARSGTKEFMEALTAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVSRDSGENLGRGTKITLYLKEDQVWTSRHTVLNFLSMLTV * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 11,925.590 | ||
Theoretical pI: | 8.597 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.677 | ||
aromaticity | 0.028 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.321 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144099.1 | 3prime_partial | 109 | 327-1(-) |
Amino Acid sequence : | |||
MTRGPYLILLEVKGDLSPPTEILTRISANRERPSSLRLPNVLFIIVVLGCHNNPLSHKVSGIESHTKLTNHAHISPSSQCLHELFGSRPCNGTEIIDKIGLGHTNTTVN | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,925.590 | ||
Theoretical pI: | 8.597 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.677 | ||
aromaticity | 0.028 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.321 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144099.1 | 5prime_partial | 120 | 1-363(+) |
Amino Acid sequence : | |||
IDSGVGMTKTDLVNNLGTIARSGTKEFMEALTAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVSRDSGENLGRGTKITLYLKEDQVWTSRHTVLNFLSMLTV * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 11,925.590 | ||
Theoretical pI: | 8.597 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.677 | ||
aromaticity | 0.028 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.321 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144099.1 | 3prime_partial | 109 | 327-1(-) |
Amino Acid sequence : | |||
MTRGPYLILLEVKGDLSPPTEILTRISANRERPSSLRLPNVLFIIVVLGCHNNPLSHKVSGIESHTKLTNHAHISPSSQCLHELFGSRPCNGTEIIDKIGLGHTNTTVN | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,925.590 | ||
Theoretical pI: | 8.597 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.677 | ||
aromaticity | 0.028 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.321 | ||
sheet | 0.211 |