| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144099.1 | 5prime_partial | 120 | 1-363(+) |
Amino Acid sequence : | |||
| IDSGVGMTKTDLVNNLGTIARSGTKEFMEALTAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVSRDSGENLGRGTKITLYLKEDQVWTSRHTVLNFLSMLTV * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 11,925.590 | ||
| Theoretical pI: | 8.597 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 50.677 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.321 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144099.1 | 3prime_partial | 109 | 327-1(-) |
Amino Acid sequence : | |||
| MTRGPYLILLEVKGDLSPPTEILTRISANRERPSSLRLPNVLFIIVVLGCHNNPLSHKVSGIESHTKLTNHAHISPSSQCLHELFGSRPCNGTEIIDKIGLGHTNTTVN | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,925.590 | ||
| Theoretical pI: | 8.597 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 50.677 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.321 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144099.1 | 5prime_partial | 120 | 1-363(+) |
Amino Acid sequence : | |||
| IDSGVGMTKTDLVNNLGTIARSGTKEFMEALTAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVSRDSGENLGRGTKITLYLKEDQVWTSRHTVLNFLSMLTV * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 11,925.590 | ||
| Theoretical pI: | 8.597 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 50.677 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.321 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144099.1 | 3prime_partial | 109 | 327-1(-) |
Amino Acid sequence : | |||
| MTRGPYLILLEVKGDLSPPTEILTRISANRERPSSLRLPNVLFIIVVLGCHNNPLSHKVSGIESHTKLTNHAHISPSSQCLHELFGSRPCNGTEIIDKIGLGHTNTTVN | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,925.590 | ||
| Theoretical pI: | 8.597 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 50.677 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.321 | ||
| sheet | 0.211 | ||