| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144117.1 | internal | 155 | 1-465(+) |
Amino Acid sequence : | |||
| KGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANL LYSFNWELPAGIFKDDINMDESPGIAIHRKYALHL | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,818.434 | ||
| Theoretical pI: | 5.854 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 36.694 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.221 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.219 | ||
| sheet | 0.271 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144117.1 | internal | 155 | 1-465(+) |
Amino Acid sequence : | |||
| KGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANL LYSFNWELPAGIFKDDINMDESPGIAIHRKYALHL | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,818.434 | ||
| Theoretical pI: | 5.854 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 36.694 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.221 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.219 | ||
| sheet | 0.271 | ||