Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144129.1 | 5prime_partial | 170 | 2-514(+) |
Amino Acid sequence : | |||
HEKISCVTYSISKFSELISPINAVALTREREKDAKNIKRLLEEGDLVKCPEGTTCREPFLLRFSALFAELTDRIVPVAVNTKQSMFYGTSTRGWKLLDPYFVFMNPRPTYEITFLNQLPK ELTCAGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKYALLAGTDGVVRN* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 14,833.168 | ||
Theoretical pI: | 8.184 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 53.987 | ||
aromaticity | 0.015 | ||
GRAVY | -1.186 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.214 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144129.1 | 5prime_partial | 131 | 1-396(+) |
Amino Acid sequence : | |||
AREDQLRHLQHQQILRTHLPDQRGGANPREREGCQEHQASSGRRGPGQMPRRHDLSRAVSAAVQRALRRAHRPDRSGRGQHETEHVLWDVDERVEAFGPLLCVHEPQADLRDHVPEPAAE GANVRGREVAN* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,833.168 | ||
Theoretical pI: | 8.184 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 53.987 | ||
aromaticity | 0.015 | ||
GRAVY | -1.186 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.214 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144129.1 | 5prime_partial | 170 | 2-514(+) |
Amino Acid sequence : | |||
HEKISCVTYSISKFSELISPINAVALTREREKDAKNIKRLLEEGDLVKCPEGTTCREPFLLRFSALFAELTDRIVPVAVNTKQSMFYGTSTRGWKLLDPYFVFMNPRPTYEITFLNQLPK ELTCAGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKYALLAGTDGVVRN* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 14,833.168 | ||
Theoretical pI: | 8.184 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 53.987 | ||
aromaticity | 0.015 | ||
GRAVY | -1.186 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.214 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144129.1 | 5prime_partial | 131 | 1-396(+) |
Amino Acid sequence : | |||
AREDQLRHLQHQQILRTHLPDQRGGANPREREGCQEHQASSGRRGPGQMPRRHDLSRAVSAAVQRALRRAHRPDRSGRGQHETEHVLWDVDERVEAFGPLLCVHEPQADLRDHVPEPAAE GANVRGREVAN* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,833.168 | ||
Theoretical pI: | 8.184 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 53.987 | ||
aromaticity | 0.015 | ||
GRAVY | -1.186 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.214 | ||
sheet | 0.282 |