| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144132.1 | complete | 105 | 18-335(+) |
Amino Acid sequence : | |||
| MGGRLSYIFVSMLLLSASLCLAQQEEDPENKRCKAALNQGAPRCFDDLYENETLPTGVVCCKNYLDMDSTSPTCWDRLFEDPSSAKNLEDALTKCKSIIKTSALE* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,662.188 | ||
| Theoretical pI: | 4.682 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 43.694 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.291 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.229 | ||
| sheet | 0.314 | ||