Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144137.1 | internal | 156 | 1-468(+) |
Amino Acid sequence : | |||
PGLKKLFDIDLRNLKLLAEYFQRSETFGGPTRDWIGIYDECSKILYEEIDYINEGKNADRFRRDYRNIKWVRIPLIYWDYTSTKVLTLEYVPGIKINNLDQLDADGNSRSQIASRAIESY LIQILKTGFFHADPHPGNLAIDTDGSLIYYDFGMMG | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 18,142.340 | ||
Theoretical pI: | 5.187 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 32890 | ||
Instability index: | 33.764 | ||
aromaticity | 0.135 | ||
GRAVY | -0.406 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.218 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144137.1 | internal | 156 | 1-468(+) |
Amino Acid sequence : | |||
PGLKKLFDIDLRNLKLLAEYFQRSETFGGPTRDWIGIYDECSKILYEEIDYINEGKNADRFRRDYRNIKWVRIPLIYWDYTSTKVLTLEYVPGIKINNLDQLDADGNSRSQIASRAIESY LIQILKTGFFHADPHPGNLAIDTDGSLIYYDFGMMG | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 18,142.340 | ||
Theoretical pI: | 5.187 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 32890 | ||
Instability index: | 33.764 | ||
aromaticity | 0.135 | ||
GRAVY | -0.406 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.218 | ||
sheet | 0.212 |