| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144159.1 | internal | 115 | 2-346(+) |
Amino Acid sequence : | |||
| KTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEITGGPDVPFHPGREDKPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLG | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,242.727 | ||
| Theoretical pI: | 5.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 32.568 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.270 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144159.1 | internal | 115 | 2-346(+) |
Amino Acid sequence : | |||
| KTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEITGGPDVPFHPGREDKPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLG | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,242.727 | ||
| Theoretical pI: | 5.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 32.568 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.270 | ||
| sheet | 0.252 | ||