| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144162.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
| KFSSSPPPLCTNQTSSPSSIQLLKRLDSLLSHVREDQSETKHAENLTRMRTQFPQLEDPLECMKTIDSLHRLGIDYHFKKEIKDMLGPIYERFCQIEDHLITGDLFEISLSFRLLRQAGH CVSSDVFYKFVDDKQQFDSSLRTDIKGLLNLHEASYLNTGEEILYRANEFTIEHLLTSHMESEDVASLIGQTLRSPIHKTLSRYNSPYYINRCQEKLTRYGVLNE | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 26,117.256 | ||
| Theoretical pI: | 5.940 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13660 | ||
| Instability index: | 54.741 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.530 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.218 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144162.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
| KFSSSPPPLCTNQTSSPSSIQLLKRLDSLLSHVREDQSETKHAENLTRMRTQFPQLEDPLECMKTIDSLHRLGIDYHFKKEIKDMLGPIYERFCQIEDHLITGDLFEISLSFRLLRQAGH CVSSDVFYKFVDDKQQFDSSLRTDIKGLLNLHEASYLNTGEEILYRANEFTIEHLLTSHMESEDVASLIGQTLRSPIHKTLSRYNSPYYINRCQEKLTRYGVLNE | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 26,117.256 | ||
| Theoretical pI: | 5.940 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13660 | ||
| Instability index: | 54.741 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.530 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.218 | ||
| sheet | 0.253 | ||