| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144186.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
| ARVDAGKEREKKSKEVDVSEDKGKEVSSKDRDVGSSSRGKVVPRLQKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVKKEYELDDTQMGVIMNGFMVWCIDN GTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVNSKTSDRAR | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 24,516.624 | ||
| Theoretical pI: | 7.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 32.395 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.752 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.222 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144186.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
| ARVDAGKEREKKSKEVDVSEDKGKEVSSKDRDVGSSSRGKVVPRLQKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVKKEYELDDTQMGVIMNGFMVWCIDN GTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVNSKTSDRAR | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 24,516.624 | ||
| Theoretical pI: | 7.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 32.395 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.752 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.222 | ||
| sheet | 0.250 | ||