Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144189.1 | complete | 142 | 58-486(+) |
Amino Acid sequence : | |||
MEITPPDTKRWVVFYPIYINSKKTIAEGRRIAAAKSCENPTCFDIGACCEYLKLPCAVEVDKAYPRDFMQRGRVRVLLKRDDRSLSNPAVPSRKQLMVQVAELVPKYQLRTKKPEPVTAS SSVPSKSNSVSSKSGKGGKKKK* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 12,827.318 | ||
Theoretical pI: | 8.730 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 67.746 | ||
aromaticity | 0.109 | ||
GRAVY | -0.794 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.255 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144189.1 | 5prime_partial | 110 | 3-335(+) |
Amino Acid sequence : | |||
CFSFCCWIWKFVSKESLNDGNNTARYEEMGCVLPNLHKFQEDDRRGPADRRRQVLREPHLLRYRRLLRISEASLCRRGGQGIPSGFYAEREGEGVAEEGRQISFESRGPF* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,827.318 | ||
Theoretical pI: | 8.730 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 67.746 | ||
aromaticity | 0.109 | ||
GRAVY | -0.794 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.255 | ||
sheet | 0.245 |