| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144199.1 | internal | 142 | 3-428(+) |
Amino Acid sequence : | |||
| NGIIATYISLPATLHPGVTVVVCPLLSLIQDQIVALNMKYGIPATFLNSQQTASQASAVMRELRKGMPSCKLLYVTPERIAGNVSFLDILNCLHRKGLLARFVIDEAHCVSQWGHDFRPD YRALGCLKQNFPEVPVMALTAT | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,594.154 | ||
| Theoretical pI: | 8.690 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 31.639 | ||
| aromaticity | 0.070 | ||
| GRAVY | 0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.218 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144199.1 | internal | 142 | 3-428(+) |
Amino Acid sequence : | |||
| NGIIATYISLPATLHPGVTVVVCPLLSLIQDQIVALNMKYGIPATFLNSQQTASQASAVMRELRKGMPSCKLLYVTPERIAGNVSFLDILNCLHRKGLLARFVIDEAHCVSQWGHDFRPD YRALGCLKQNFPEVPVMALTAT | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,594.154 | ||
| Theoretical pI: | 8.690 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 31.639 | ||
| aromaticity | 0.070 | ||
| GRAVY | 0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.218 | ||
| sheet | 0.275 | ||