| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144215.1 | internal | 180 | 3-542(+) |
Amino Acid sequence : | |||
| KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 15,547.858 | ||
| Theoretical pI: | 5.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 40.791 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.262 | ||
| sheet | 0.319 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144215.1 | 5prime_partial | 141 | 542-117(-) |
Amino Acid sequence : | |||
| VVVSEGTTVLKLLPSKDEPLLVRWDPLLVLNFRLNIVDSVGALHLQGNGLPSQSLDKNLHPTPEPEHQMKGRLLLDVVIGEGTAVLKLFPRKDEPLLIRRDPLLVLDLGLHVVDSIGALH LEGYGLPRESLHEDLHPSPEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,547.858 | ||
| Theoretical pI: | 5.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 40.791 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.262 | ||
| sheet | 0.319 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144215.1 | internal | 180 | 3-542(+) |
Amino Acid sequence : | |||
| KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 15,547.858 | ||
| Theoretical pI: | 5.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 40.791 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.262 | ||
| sheet | 0.319 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144215.1 | 5prime_partial | 141 | 542-117(-) |
Amino Acid sequence : | |||
| VVVSEGTTVLKLLPSKDEPLLVRWDPLLVLNFRLNIVDSVGALHLQGNGLPSQSLDKNLHPTPEPEHQMKGRLLLDVVIGEGTAVLKLFPRKDEPLLIRRDPLLVLDLGLHVVDSIGALH LEGYGLPRESLHEDLHPSPEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,547.858 | ||
| Theoretical pI: | 5.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 40.791 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.262 | ||
| sheet | 0.319 | ||