| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144224.1 | internal | 186 | 2-559(+) |
Amino Acid sequence : | |||
| KDYFVDERKKLASTRAMDNAGLKCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPL LVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIP | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 13,150.841 | ||
| Theoretical pI: | 4.644 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 34.681 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.197 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144224.1 | 5prime_partial | 117 | 559-206(-) |
Amino Acid sequence : | |||
| GNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFLDVGLGDLNARAEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,150.841 | ||
| Theoretical pI: | 4.644 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 34.681 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.197 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144224.1 | internal | 186 | 2-559(+) |
Amino Acid sequence : | |||
| KDYFVDERKKLASTRAMDNAGLKCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPL LVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIP | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 13,150.841 | ||
| Theoretical pI: | 4.644 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 34.681 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.197 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144224.1 | 5prime_partial | 117 | 559-206(-) |
Amino Acid sequence : | |||
| GNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFLDVGLGDLNARAEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,150.841 | ||
| Theoretical pI: | 4.644 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 34.681 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.197 | ||
| sheet | 0.291 | ||