Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144229.1 | 5prime_partial | 177 | 1-534(+) |
Amino Acid sequence : | |||
SPGLQEFGTSQEEIKPYMASLTTTSSFALFFTLNLLLFVFATSCSTCPSPIPKPKPKPKPTPCPGTPSTPTPTPSTPSTPTPTPTPSTPSGTGKCPIDTLKLGVCADVLGLIGISIGSKP KTACCSLLGNLANLDAAVCLCTTLRAGILGINLNIPVDLSLLLNYCGKSAPSGFQCS* | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 15,233.661 | ||
Theoretical pI: | 11.107 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 47.932 | ||
aromaticity | 0.063 | ||
GRAVY | 0.179 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.306 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144229.1 | complete | 144 | 464-30(-) |
Amino Acid sequence : | |||
MLRLMPRMPALSVVQRHTAASRFARFPRSEQQAVFGLLPMLMPMRPSTSAHTPSFSVSMGHLPVPDGVLGVGVGVGVDGVLGVGVGVDGVPGHGVGFGFGFGFGMGDGQVLHEVANTKRR RLRVKKRAKEEVVVNEAIYGLISS* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,233.661 | ||
Theoretical pI: | 11.107 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 47.932 | ||
aromaticity | 0.063 | ||
GRAVY | 0.179 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.306 | ||
sheet | 0.236 |