| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144234.1 | 5prime_partial | 169 | 2-511(+) |
Amino Acid sequence : | |||
| DLKAYDGSDPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLA EGQAEHSAESKEDNTPAKEEDTPTGDGDAEAKYVAELKEVVEEDKKTEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 15,962.842 | ||
| Theoretical pI: | 9.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 47.311 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.386 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144234.1 | 5prime_partial | 153 | 555-94(-) |
Amino Acid sequence : | |||
| LVQTVGTQHRYQLKTYSSVFLSSSTTSFSSATYLASASPSPVGVSSSLAGVLSSFDSALCSAWPSARPRSVVRVDASVTSASVGPSVSGTDFFMVPTLVYLLMNLYSQSWRASSSKGPRP DMSPVKSLSSKDIFARALLASLPANNAYGPPGP* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 15,962.842 | ||
| Theoretical pI: | 9.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 47.311 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.386 | ||
| sheet | 0.216 | ||