Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144234.1 | 5prime_partial | 169 | 2-511(+) |
Amino Acid sequence : | |||
DLKAYDGSDPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLA EGQAEHSAESKEDNTPAKEEDTPTGDGDAEAKYVAELKEVVEEDKKTEE* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 15,962.842 | ||
Theoretical pI: | 9.839 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 47.311 | ||
aromaticity | 0.092 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.386 | ||
sheet | 0.216 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144234.1 | 5prime_partial | 153 | 555-94(-) |
Amino Acid sequence : | |||
LVQTVGTQHRYQLKTYSSVFLSSSTTSFSSATYLASASPSPVGVSSSLAGVLSSFDSALCSAWPSARPRSVVRVDASVTSASVGPSVSGTDFFMVPTLVYLLMNLYSQSWRASSSKGPRP DMSPVKSLSSKDIFARALLASLPANNAYGPPGP* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,962.842 | ||
Theoretical pI: | 9.839 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 47.311 | ||
aromaticity | 0.092 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.386 | ||
sheet | 0.216 |