| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144245.1 | internal | 190 | 3-572(+) |
Amino Acid sequence : | |||
| TDIRSKARTLTGPITSPSQLPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRRGDNILVMCDCYTPAGEPIPTNKRANAAKIFSHPDVAAEVTWYGLEQEYTLLQKDVKWPLGWPIGGF PGPQGPYYCAAGADKAFGRDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWIARYI | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 20,729.131 | ||
| Theoretical pI: | 5.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48150 | ||
| Instability index: | 46.254 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.284 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144245.1 | internal | 190 | 3-572(+) |
Amino Acid sequence : | |||
| TDIRSKARTLTGPITSPSQLPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRRGDNILVMCDCYTPAGEPIPTNKRANAAKIFSHPDVAAEVTWYGLEQEYTLLQKDVKWPLGWPIGGF PGPQGPYYCAAGADKAFGRDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWIARYI | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 20,729.131 | ||
| Theoretical pI: | 5.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48150 | ||
| Instability index: | 46.254 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.284 | ||
| sheet | 0.200 | ||