Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144249.1 | internal | 132 | 1-396(+) |
Amino Acid sequence : | |||
AREAEEMGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNED ELRDAVLLVFAN | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 11,165.248 | ||
Theoretical pI: | 10.675 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
Instability index: | 71.638 | ||
aromaticity | 0.080 | ||
GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.320 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144249.1 | 5prime_partial | 123 | 396-25(-) |
Amino Acid sequence : | |||
VSKHKQNSIPQLILIEHPVELIPGLHNTISVIAVNNKDKTLGVLKVVPPQRSDLILTPHIPNSETNVLVFHSLHIKSDGGYRGDDLTELELVEDGGLTGSIETNHQDPHLLLRKETAKQL RKS* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 11,165.248 | ||
Theoretical pI: | 10.675 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
Instability index: | 71.638 | ||
aromaticity | 0.080 | ||
GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.320 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144249.1 | 3prime_partial | 100 | 95-394(+) |
Amino Acid sequence : | |||
MLPVRPPSSTSSSSVRSSPRYPPSDLMWRLWNTRTLVSLFGMWGVRIRSDLCGGTTFRTPKVLSLLLTAMTEIVLWRPGMSSTGCSMRMSCGMLFCLCLL | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,165.248 | ||
Theoretical pI: | 10.675 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
Instability index: | 71.638 | ||
aromaticity | 0.080 | ||
GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.320 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144249.1 | internal | 132 | 1-396(+) |
Amino Acid sequence : | |||
AREAEEMGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNED ELRDAVLLVFAN | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 11,165.248 | ||
Theoretical pI: | 10.675 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
Instability index: | 71.638 | ||
aromaticity | 0.080 | ||
GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.320 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144249.1 | 5prime_partial | 123 | 396-25(-) |
Amino Acid sequence : | |||
VSKHKQNSIPQLILIEHPVELIPGLHNTISVIAVNNKDKTLGVLKVVPPQRSDLILTPHIPNSETNVLVFHSLHIKSDGGYRGDDLTELELVEDGGLTGSIETNHQDPHLLLRKETAKQL RKS* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 11,165.248 | ||
Theoretical pI: | 10.675 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
Instability index: | 71.638 | ||
aromaticity | 0.080 | ||
GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.320 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144249.1 | 3prime_partial | 100 | 95-394(+) |
Amino Acid sequence : | |||
MLPVRPPSSTSSSSVRSSPRYPPSDLMWRLWNTRTLVSLFGMWGVRIRSDLCGGTTFRTPKVLSLLLTAMTEIVLWRPGMSSTGCSMRMSCGMLFCLCLL | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,165.248 | ||
Theoretical pI: | 10.675 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
Instability index: | 71.638 | ||
aromaticity | 0.080 | ||
GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.320 | ||
sheet | 0.250 |