| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144257.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
| LEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKH AARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYN | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 20,393.188 | ||
| Theoretical pI: | 7.767 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 28.962 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.211 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.272 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144257.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
| LEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKH AARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYN | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 20,393.188 | ||
| Theoretical pI: | 7.767 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 28.962 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.211 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.272 | ||
| sheet | 0.226 | ||