| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144262.1 | internal | 159 | 3-479(+) |
Amino Acid sequence : | |||
| NDRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYYK KMSKPGEWGDHVTLQAAADKFGAKICLLTSFRDTCFVEI | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 18,337.824 | ||
| Theoretical pI: | 9.359 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 35.010 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.195 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144262.1 | internal | 159 | 3-479(+) |
Amino Acid sequence : | |||
| NDRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYYK KMSKPGEWGDHVTLQAAADKFGAKICLLTSFRDTCFVEI | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 18,337.824 | ||
| Theoretical pI: | 9.359 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 35.010 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.195 | ||
| sheet | 0.233 | ||