Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144268.1 | internal | 102 | 1-306(+) |
Amino Acid sequence : | |||
GGGSGGHDPFDIFQSFFGGSPFAGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGISQKLSLSRNVICSKCKGKGSKSGASMKCAGCQGSGMKVSIRQLGPSMI | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,579.949 | ||
Theoretical pI: | 9.967 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 47.808 | ||
aromaticity | 0.059 | ||
GRAVY | -0.409 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.412 | ||
sheet | 0.137 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144268.1 | internal | 102 | 1-306(+) |
Amino Acid sequence : | |||
GGGSGGHDPFDIFQSFFGGSPFAGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGISQKLSLSRNVICSKCKGKGSKSGASMKCAGCQGSGMKVSIRQLGPSMI | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,579.949 | ||
Theoretical pI: | 9.967 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 47.808 | ||
aromaticity | 0.059 | ||
GRAVY | -0.409 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.412 | ||
sheet | 0.137 |