| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144268.1 | internal | 102 | 1-306(+) |
Amino Acid sequence : | |||
| GGGSGGHDPFDIFQSFFGGSPFAGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGISQKLSLSRNVICSKCKGKGSKSGASMKCAGCQGSGMKVSIRQLGPSMI | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,579.949 | ||
| Theoretical pI: | 9.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 47.808 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.409 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.412 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144268.1 | internal | 102 | 1-306(+) |
Amino Acid sequence : | |||
| GGGSGGHDPFDIFQSFFGGSPFAGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGISQKLSLSRNVICSKCKGKGSKSGASMKCAGCQGSGMKVSIRQLGPSMI | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,579.949 | ||
| Theoretical pI: | 9.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 47.808 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.409 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.412 | ||
| sheet | 0.137 | ||