| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144285.1 | internal | 178 | 3-536(+) |
Amino Acid sequence : | |||
| KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 15,349.596 | ||
| Theoretical pI: | 5.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 41.234 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.266 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144285.1 | 5prime_partial | 139 | 536-117(-) |
Amino Acid sequence : | |||
| VSEGTTVLKLLPSKDEPLLVRWDPLLVLNFRLNIVDSVGALHLQGNGLPSQSLDKNLHPTPEPEHQMKGRLLLDVVIGEGTAVLKLFPRKDEPLLIRRDPLLVLDLGLHVVDSIGALHLE GYGLPRESLHEDLHPSPEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,349.596 | ||
| Theoretical pI: | 5.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 41.234 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.266 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144285.1 | internal | 178 | 3-536(+) |
Amino Acid sequence : | |||
| KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 15,349.596 | ||
| Theoretical pI: | 5.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 41.234 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.266 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144285.1 | 5prime_partial | 139 | 536-117(-) |
Amino Acid sequence : | |||
| VSEGTTVLKLLPSKDEPLLVRWDPLLVLNFRLNIVDSVGALHLQGNGLPSQSLDKNLHPTPEPEHQMKGRLLLDVVIGEGTAVLKLFPRKDEPLLIRRDPLLVLDLGLHVVDSIGALHLE GYGLPRESLHEDLHPSPEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,349.596 | ||
| Theoretical pI: | 5.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 41.234 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.266 | ||
| sheet | 0.324 | ||