Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144292.1 | complete | 163 | 2-493(+) |
Amino Acid sequence : | |||
MSLIRGQRSNVFDPFSLDIWDPLQGLGLGFPFGRSVADTNRGQQQSGDETSAFAIARVDWKETPEAHVFKADLPGLKKEEVKVEVEEGRVLQISGERSREKEEKNDTWHRVERSIGKFLR RFRLPENAKMEEVKATMENGVLMVTVPKEEVKKPEVKSIQISG* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 12,330.066 | ||
Theoretical pI: | 9.578 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 46.868 | ||
aromaticity | 0.121 | ||
GRAVY | 0.538 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.353 | ||
sheet | 0.207 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144292.1 | complete | 116 | 477-127(-) |
Amino Acid sequence : | |||
MDLTSGFLTSSLGTVTISTPFSIVAFTSSIFAFSGKRNLLKNFPMLLSTRCHVSFFSSFSLLLSPLIWSTLPSSTSTFTSSFFSPGRSALNTCASGVSFQSTRAIAKAEVSSPLCC* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,330.066 | ||
Theoretical pI: | 9.578 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 46.868 | ||
aromaticity | 0.121 | ||
GRAVY | 0.538 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.353 | ||
sheet | 0.207 |