| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144296.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
| KDLQKDPPTSCSAGPVAEDMFHWQATIMGPTDSPFAGGVFLVTIHFPPDYPFKPPKVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD RAKYESTARSWTQKYAMG* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,351.434 | ||
| Theoretical pI: | 6.449 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 45.478 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.275 | ||
| sheet | 0.196 | ||