| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144299.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
| FVGEWLEWLYADVMQRLQAGDFSTLPEAHACTAGLKSLTTTITADGIEECRKLCGGHGYLCSSGLPELFAVYVPACTYEGDNVVLLLQVARFLVKTVSLLGSGKKPVGTTSYMNRAEHLM QCRSGVCKVEDWLEPSAIVEAFEARAVRLAVSSAQNVSEASSPEQGFMEHSADLVEAAIAHCQLIIVSKFFEKAQCDIDGRGVKEQIQIL | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 14,196.053 | ||
| Theoretical pI: | 8.150 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 42.292 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.273 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144299.1 | 5prime_partial | 132 | 631-233(-) |
Amino Acid sequence : | |||
| RIWICSLTPRPSMSHCAFSKNFDTIINWQCAIAASTKSAECSIKPCSGLDASLTFCAELTASLTALASNASTMAEGSSQSSTLQTPDRHCIRCSALFIYDVVPTGFFPEPSRETVFTRNL ATCKSKTTLSPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,196.053 | ||
| Theoretical pI: | 8.150 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 42.292 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.273 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144299.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
| FVGEWLEWLYADVMQRLQAGDFSTLPEAHACTAGLKSLTTTITADGIEECRKLCGGHGYLCSSGLPELFAVYVPACTYEGDNVVLLLQVARFLVKTVSLLGSGKKPVGTTSYMNRAEHLM QCRSGVCKVEDWLEPSAIVEAFEARAVRLAVSSAQNVSEASSPEQGFMEHSADLVEAAIAHCQLIIVSKFFEKAQCDIDGRGVKEQIQIL | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 14,196.053 | ||
| Theoretical pI: | 8.150 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 42.292 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.273 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144299.1 | 5prime_partial | 132 | 631-233(-) |
Amino Acid sequence : | |||
| RIWICSLTPRPSMSHCAFSKNFDTIINWQCAIAASTKSAECSIKPCSGLDASLTFCAELTASLTALASNASTMAEGSSQSSTLQTPDRHCIRCSALFIYDVVPTGFFPEPSRETVFTRNL ATCKSKTTLSPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,196.053 | ||
| Theoretical pI: | 8.150 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 42.292 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.273 | ||
| sheet | 0.235 | ||