Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144301.1 | internal | 157 | 471-1(-) |
Amino Acid sequence : | |||
QDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRV LANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEGSN | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 16,650.471 | ||
Theoretical pI: | 5.579 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 53.379 | ||
aromaticity | 0.083 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.234 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144301.1 | 5prime_partial | 145 | 2-439(+) |
Amino Acid sequence : | |||
FDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASME NGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,650.471 | ||
Theoretical pI: | 5.579 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 53.379 | ||
aromaticity | 0.083 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.234 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144301.1 | internal | 157 | 471-1(-) |
Amino Acid sequence : | |||
QDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRV LANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEGSN | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 16,650.471 | ||
Theoretical pI: | 5.579 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 53.379 | ||
aromaticity | 0.083 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.234 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144301.1 | 5prime_partial | 145 | 2-439(+) |
Amino Acid sequence : | |||
FDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASME NGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,650.471 | ||
Theoretical pI: | 5.579 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 53.379 | ||
aromaticity | 0.083 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.234 | ||
sheet | 0.234 |