| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144305.1 | internal | 163 | 3-491(+) |
Amino Acid sequence : | |||
| TRQYEHFNKVAKVIDEILADQGAKRLIQVGLGDDDQCIEDDFTAWKELLWPELDQLLRDEDDTSGSSTTYTAAIPEYRVVFIDSAEASHMERNWSLANGHTVHDIQHPCRANVAVRRELH TPESDRSCIHLEFDIAGTGLTYETGDHVGVYSENCIETVEEAE | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 12,196.584 | ||
| Theoretical pI: | 10.920 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 49.485 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.413 | ||
| turn | 0.163 | ||
| sheet | 0.337 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144305.1 | 3prime_partial | 104 | 178-489(+) |
Amino Acid sequence : | |||
| MKMIHLAHRQHIPLLFLSTGWSSSTQQRHLIWRGTGVLQMDILYMIFSTHAGLMWLSDENFTPQNRIAPAFIWSLILLALVLPMKLETMLVYILRIALRLLKRQ | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,196.584 | ||
| Theoretical pI: | 10.920 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 49.485 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.413 | ||
| turn | 0.163 | ||
| sheet | 0.337 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144305.1 | internal | 163 | 3-491(+) |
Amino Acid sequence : | |||
| TRQYEHFNKVAKVIDEILADQGAKRLIQVGLGDDDQCIEDDFTAWKELLWPELDQLLRDEDDTSGSSTTYTAAIPEYRVVFIDSAEASHMERNWSLANGHTVHDIQHPCRANVAVRRELH TPESDRSCIHLEFDIAGTGLTYETGDHVGVYSENCIETVEEAE | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 12,196.584 | ||
| Theoretical pI: | 10.920 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 49.485 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.413 | ||
| turn | 0.163 | ||
| sheet | 0.337 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144305.1 | 3prime_partial | 104 | 178-489(+) |
Amino Acid sequence : | |||
| MKMIHLAHRQHIPLLFLSTGWSSSTQQRHLIWRGTGVLQMDILYMIFSTHAGLMWLSDENFTPQNRIAPAFIWSLILLALVLPMKLETMLVYILRIALRLLKRQ | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,196.584 | ||
| Theoretical pI: | 10.920 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 49.485 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.413 | ||
| turn | 0.163 | ||
| sheet | 0.337 | ||