Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144305.1 | internal | 163 | 3-491(+) |
Amino Acid sequence : | |||
TRQYEHFNKVAKVIDEILADQGAKRLIQVGLGDDDQCIEDDFTAWKELLWPELDQLLRDEDDTSGSSTTYTAAIPEYRVVFIDSAEASHMERNWSLANGHTVHDIQHPCRANVAVRRELH TPESDRSCIHLEFDIAGTGLTYETGDHVGVYSENCIETVEEAE | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 12,196.584 | ||
Theoretical pI: | 10.920 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
Instability index: | 49.485 | ||
aromaticity | 0.096 | ||
GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.413 | ||
turn | 0.163 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144305.1 | 3prime_partial | 104 | 178-489(+) |
Amino Acid sequence : | |||
MKMIHLAHRQHIPLLFLSTGWSSSTQQRHLIWRGTGVLQMDILYMIFSTHAGLMWLSDENFTPQNRIAPAFIWSLILLALVLPMKLETMLVYILRIALRLLKRQ | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 12,196.584 | ||
Theoretical pI: | 10.920 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
Instability index: | 49.485 | ||
aromaticity | 0.096 | ||
GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.413 | ||
turn | 0.163 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144305.1 | internal | 163 | 3-491(+) |
Amino Acid sequence : | |||
TRQYEHFNKVAKVIDEILADQGAKRLIQVGLGDDDQCIEDDFTAWKELLWPELDQLLRDEDDTSGSSTTYTAAIPEYRVVFIDSAEASHMERNWSLANGHTVHDIQHPCRANVAVRRELH TPESDRSCIHLEFDIAGTGLTYETGDHVGVYSENCIETVEEAE | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 12,196.584 | ||
Theoretical pI: | 10.920 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
Instability index: | 49.485 | ||
aromaticity | 0.096 | ||
GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.413 | ||
turn | 0.163 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144305.1 | 3prime_partial | 104 | 178-489(+) |
Amino Acid sequence : | |||
MKMIHLAHRQHIPLLFLSTGWSSSTQQRHLIWRGTGVLQMDILYMIFSTHAGLMWLSDENFTPQNRIAPAFIWSLILLALVLPMKLETMLVYILRIALRLLKRQ | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 12,196.584 | ||
Theoretical pI: | 10.920 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
Instability index: | 49.485 | ||
aromaticity | 0.096 | ||
GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.413 | ||
turn | 0.163 | ||
sheet | 0.337 |