| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144311.1 | internal | 112 | 1-336(+) |
Amino Acid sequence : | |||
| VPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRTLQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASMENGVLTVTVPKAE | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,555.801 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.526 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.250 | ||
| sheet | 0.366 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144311.1 | internal | 112 | 338-3(-) |
Amino Acid sequence : | |||
| TSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRVLPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARG | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,555.801 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.526 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.250 | ||
| sheet | 0.366 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144311.1 | internal | 112 | 3-338(+) |
Amino Acid sequence : | |||
| SPCELELSERDFCVRQHPHRLEGDAGGARVQGRPPRNQEGGGEGGSGGGEDPPDQRGEEEGAGGEERHVAPRGEEQREVSEEVPDAGEREGGGGEGFDGERSSYRYRAEGGG | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,555.801 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.526 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.250 | ||
| sheet | 0.366 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144311.1 | internal | 112 | 336-1(-) |
Amino Acid sequence : | |||
| LRLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEGPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGN | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,555.801 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.526 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.250 | ||
| sheet | 0.366 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144311.1 | internal | 112 | 1-336(+) |
Amino Acid sequence : | |||
| VPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRTLQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASMENGVLTVTVPKAE | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,555.801 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.526 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.250 | ||
| sheet | 0.366 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144311.1 | internal | 112 | 338-3(-) |
Amino Acid sequence : | |||
| TSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRVLPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARG | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,555.801 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.526 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.250 | ||
| sheet | 0.366 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144311.1 | internal | 112 | 3-338(+) |
Amino Acid sequence : | |||
| SPCELELSERDFCVRQHPHRLEGDAGGARVQGRPPRNQEGGGEGGSGGGEDPPDQRGEEEGAGGEERHVAPRGEEQREVSEEVPDAGEREGGGGEGFDGERSSYRYRAEGGG | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,555.801 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.526 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.250 | ||
| sheet | 0.366 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144311.1 | internal | 112 | 336-1(-) |
Amino Acid sequence : | |||
| LRLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEGPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGN | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,555.801 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.526 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.250 | ||
| sheet | 0.366 | ||