Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144314.1 | 3prime_partial | 204 | 45-656(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFY | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 21,435.546 | ||
Theoretical pI: | 7.631 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
Instability index: | 27.559 | ||
aromaticity | 0.054 | ||
GRAVY | 0.244 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.260 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144314.1 | 3prime_partial | 204 | 45-656(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFY | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 21,435.546 | ||
Theoretical pI: | 7.631 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
Instability index: | 27.559 | ||
aromaticity | 0.054 | ||
GRAVY | 0.244 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.260 | ||
sheet | 0.235 |