Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144316.1 | internal | 189 | 568-2(-) |
Amino Acid sequence : | |||
FILEAHHKRGNDRDRGLETDRRKRSIDRSTGDVNGFDFRLLNLRLRHGNGKNSVLHRSLHLLHLRVLRHPEPPHKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPFLHFHLHLLLLDSGE VGLEHVRLRRLLPVYAGVGERRNLAARKVRVRTGNHVAEEAIDRIPGIERSRPESKWNKRHLDRIRASL | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 17,330.454 | ||
Theoretical pI: | 6.201 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 45.551 | ||
aromaticity | 0.079 | ||
GRAVY | -0.695 | ||
Secondary Structure Fraction | |||
Helix | 0.263 | ||
turn | 0.243 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144316.1 | 5prime_partial | 184 | 567-13(-) |
Amino Acid sequence : | |||
LFSRHITKEGTTETGDWRPTDVSGRSIDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEAFTSSTFAFSGIRNLLINFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGR SALNTCASGVSFQSMRVLANAEISPLGKFEFARGTTSRKRLSIGSQGSNARDPNPNGISDISIE* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 17,330.454 | ||
Theoretical pI: | 6.201 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 45.551 | ||
aromaticity | 0.079 | ||
GRAVY | -0.695 | ||
Secondary Structure Fraction | |||
Helix | 0.263 | ||
turn | 0.243 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144316.1 | complete | 152 | 26-484(+) |
Amino Acid sequence : | |||
MSLIPFGFGSRAFDPWDPIDSLFRDVVPRANSNFPSGEISAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFMRRFRMPENAKVE EVKASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,330.454 | ||
Theoretical pI: | 6.201 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 45.551 | ||
aromaticity | 0.079 | ||
GRAVY | -0.695 | ||
Secondary Structure Fraction | |||
Helix | 0.263 | ||
turn | 0.243 | ||
sheet | 0.243 |