| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144321.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
| HEEELKAYDGSDPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTER GLAEGQAEHSAESKEDNTPAKEEDTPTGDGDA | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 12,033.540 | ||
| Theoretical pI: | 9.740 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 55.673 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.419 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144321.1 | 5prime_partial | 117 | 456-103(-) |
Amino Acid sequence : | |||
| ASPSPVGVSSSLAGVLSSFDSALCSAWPSARPRSVVRVDASVTSASVGPSVSGTDFFMVPTLVYLLMNLYSQSWRASSSKGPRPDMSPVKSLSSKDIFARALLASLPANNAYGPPGP* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,033.540 | ||
| Theoretical pI: | 9.740 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 55.673 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.419 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144321.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
| HEEELKAYDGSDPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTER GLAEGQAEHSAESKEDNTPAKEEDTPTGDGDA | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 12,033.540 | ||
| Theoretical pI: | 9.740 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 55.673 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.419 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144321.1 | 5prime_partial | 117 | 456-103(-) |
Amino Acid sequence : | |||
| ASPSPVGVSSSLAGVLSSFDSALCSAWPSARPRSVVRVDASVTSASVGPSVSGTDFFMVPTLVYLLMNLYSQSWRASSSKGPRPDMSPVKSLSSKDIFARALLASLPANNAYGPPGP* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,033.540 | ||
| Theoretical pI: | 9.740 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 55.673 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.419 | ||
| sheet | 0.231 | ||