| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144322.1 | complete | 142 | 52-480(+) |
Amino Acid sequence : | |||
| MEITPPDTKRWVVFYPIYINSKKTIAEGRRIAAAKSCENPTCFDIGACCEYLKLPCAVEVDKAYPRDFMQRGRVRVLLKRDDRSLSNPAVPSRKQLMVQVAELVPKYQLRTKKPEPVTAS SSVPSKSNSVSSKSGKGGKKKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 12,577.002 | ||
| Theoretical pI: | 8.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 68.815 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.857 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.259 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144322.1 | 5prime_partial | 108 | 3-329(+) |
Amino Acid sequence : | |||
| SFCCWIWKFVSKESLNDGNNTARYEEMGCVLPNLHKFQEDDRRGPADRRRQVLREPHLLRYRRLLRISEASLCRRGGQGIPSGFYAEREGEGVAEEGRQISFESRGPF* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,577.002 | ||
| Theoretical pI: | 8.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 68.815 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.857 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.259 | ||
| sheet | 0.250 | ||