Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144325.1 | complete | 165 | 519-22(-) |
Amino Acid sequence : | |||
MTPSGQILPSKEYSTSIKKCLSPQKNIVPLRSHKIIKQNDISCIMDLMKRKDLCCGLLEISNKIGTILWLLQTRKHHLGTRNILLRVKQVIVEGRLPPIHSHSLVRSRVRITRSRARLSP EESVQVRPLLVAGTFFDGMALGALRLEDLLSSLFIAGRSFVERRH* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 12,142.694 | ||
Theoretical pI: | 9.369 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 24.922 | ||
aromaticity | 0.098 | ||
GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.295 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144325.1 | complete | 112 | 25-363(+) |
Amino Acid sequence : | |||
MASFNEAPPGNEKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKGMAVNWGETTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,142.694 | ||
Theoretical pI: | 9.369 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 24.922 | ||
aromaticity | 0.098 | ||
GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.295 | ||
sheet | 0.250 |