Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144332.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
ISASHNHASFVMQSGEVFTCGDNSSYCCGHGEVGRAIFRPTRIESLKGIPCKQVATGLSFTVFLTMQGHVYTCGNNTHGQLGHADTLDRPIPRKVEAFEGLGHVVQVAAGASYTFALTDD GTVHSFGSCTNFCLGHGDQHDELLPRAIQSFQRRNIHVVRVSAGDEHAVALDSSGYVYTWG | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 19,483.502 | ||
Theoretical pI: | 6.294 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
Instability index: | 21.212 | ||
aromaticity | 0.088 | ||
GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.260 | ||
sheet | 0.188 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144332.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
ISASHNHASFVMQSGEVFTCGDNSSYCCGHGEVGRAIFRPTRIESLKGIPCKQVATGLSFTVFLTMQGHVYTCGNNTHGQLGHADTLDRPIPRKVEAFEGLGHVVQVAAGASYTFALTDD GTVHSFGSCTNFCLGHGDQHDELLPRAIQSFQRRNIHVVRVSAGDEHAVALDSSGYVYTWG | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 19,483.502 | ||
Theoretical pI: | 6.294 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
Instability index: | 21.212 | ||
aromaticity | 0.088 | ||
GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.260 | ||
sheet | 0.188 |