| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144336.1 | internal | 187 | 2-562(+) |
Amino Acid sequence : | |||
| QSSAPNLPYTSSQTLEGIKSGAKKIRRTFVLSASNIQTLKQRAMRRDSNNMKPSTFLAISAHLWSCFVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSED RLSRACEEIGASIRRVSEDPLRDVEDWFDDLQNLPLERVTNVTASPRFKIYETDFGFGRPDRVELVS | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 21,073.539 | ||
| Theoretical pI: | 6.805 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 53.579 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.454 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.262 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144336.1 | internal | 187 | 2-562(+) |
Amino Acid sequence : | |||
| QSSAPNLPYTSSQTLEGIKSGAKKIRRTFVLSASNIQTLKQRAMRRDSNNMKPSTFLAISAHLWSCFVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSED RLSRACEEIGASIRRVSEDPLRDVEDWFDDLQNLPLERVTNVTASPRFKIYETDFGFGRPDRVELVS | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 21,073.539 | ||
| Theoretical pI: | 6.805 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 53.579 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.454 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.262 | ||
| sheet | 0.214 | ||